PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000207866
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family HB-other
Protein Properties Length: 252aa    MW: 28819.9 Da    PI: 7.324
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000207866genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.51.3e-191974257
                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
       Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                   +kR   t+ ql +Le+++++++yp++e++ +LA++l+L+e+q++ WF+ rR k+k+
  MDP0000207866 19 KKRKLKTPAQLMALEKFYNEHKYPTEEMKSQLAEQLRLSEKQISGWFCHRRLKDKR 74
                   89****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.7E-21274IPR009057Homeodomain-like
PROSITE profilePS5007117.1511575IPR001356Homeobox domain
SMARTSM003896.1E-191779IPR001356Homeobox domain
SuperFamilySSF466894.11E-181782IPR009057Homeodomain-like
CDDcd000862.95E-171974No hitNo description
PfamPF000464.2E-171974IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MESNELHSEE NKNSQDNNKK RKLKTPAQLM ALEKFYNEHK YPTEEMKSQL AEQLRLSEKQ  60
ISGWFCHRRL KDKRLSRDET QANGRQDRSS VVIQDRASGL GQDSCGSTKH GEHRFVDPRE  120
VESRRLSGHD FTSADITREY RSHYTERVGD MDNTSSESSS SLQDRLLTRK EDPYDVETSR  180
YLTHTKGMEN MGYKPSGFMK VKGEAENAAI TAVKRQLGRQ YWEDGPLLGV EFDLLPRGAF  240
ESPIIGSGHG TS
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.58870.0cell culture| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008375850.10.0PREDICTED: uncharacterized protein LOC103439076
RefseqXP_008391024.10.0PREDICTED: uncharacterized protein LOC103453257
TrEMBLM5WMQ71e-152M5WMQ7_PRUPE; Uncharacterized protein
STRINGGLYMA14G03850.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF57923051
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G03250.16e-82HB-other family protein